PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0061s0057.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 335aa    MW: 36054.6 Da    PI: 6.0435
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0061s0057.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.51.5e-17237270134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Kaladp0061s0057.2.p 237 CLHCEMTKTPQWRAGPMGPKTLCNACGVRYKSGR 270
                          99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-713308IPR016679Transcription factor, GATA, plant
SMARTSM004012.2E-14231281IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.24231267IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-14235268IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577168.55E-15235294No hitNo description
CDDcd002024.36E-14236285No hitNo description
PfamPF003203.6E-15237270IPR000679Zinc finger, GATA-type
PROSITE patternPS003440237262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MSADPTSFAA DDIDCNNFFD HMEDLLDFPE DNSKSTDSAL LGLAWNTSPH SILNPDPLFV  60
GKSTGCTPDL AAALSLPYED IVQMEWLSTF VEDSFSGGNS MTFDRQNLPD TEDPSVAPFQ  120
FLSMSPISVL ESSSSSSSCS EGGKVLPRRP DSNVRIGGGC GRARSKRPRP LAFRPVSATQ  180
LISPPLAFNS FSESRSLTAG QRKKRKMNPL SSATPAAETT SGADLTASQS QAGLRKCLHC  240
EMTKTPQWRA GPMGPKTLCN ACGVRYKSGR LFPEYRPAAS PTFIPSLHSN SHKKVLEMRT  300
SSIDVPAAML PGGKTASDTQ PEFIPNENAM LEYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165169KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00047PBMTransfer from AT1G08000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316371.23e-91zinc finger family protein
RefseqXP_006378769.13e-91hypothetical protein POPTR_0010s23010g
TrEMBLB9HUF83e-91B9HUF8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s23010.18e-91(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.19e-42GATA transcription factor 9